LRRC36 Recombinant Protein Antigen

Name LRRC36 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-31597PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody LRRC36 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene LRRC36
Sequence FIPFPNREIKDSLSTSATQGNGTRDQKLDTFPLGTQTQEVARREMPSDNHQEDEFRHYSPRQSTVRSPEKMTREGYQVSF
Description A recombinant protein antigen corresponding to LRRC36
Supplier Page Shop