SLC16A6 Recombinant Protein Antigen

Name SLC16A6 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-31578PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody SLC16A6 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene SLC16A6
Sequence PASPKIVIQENRKEAQYMLENEKTRTSIDSIDSGVELTTSPKNVPTHTNLELEPKADMQQVLVKTSPRPSEKKAPLL
Description A recombinant protein antigen corresponding to SLC16A6
Supplier Page Shop