C12orf56 Recombinant Protein Antigen

Name C12orf56 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-30788PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody C12orf56 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene C12orf56
Sequence RSLKESILRDQQESSTPSKDSTLCPRPGLKKLSLHGQGAFRPLPSPSRRSSQSAPTTGKAVSEPSCTTNTKEPQGLPDHNSIS
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human C12orf56
Supplier Page Shop