Active dog IL3 full length protein

• Supplier: Abcam
• Catalog: ab201436
• Category: Protein
• Prices: $101.00
• Sizes: 2 µg
• Applications: SDS-PAGE FA HPLC
• Species Reactivities: Dog
• Nature: Recombinant
• Source: E. coli
• Purity: > 97 % by SDS-PAGE. > 97 % by HPLC.
• Bioactivity: The ED 50 as determined by the dose-dependant stimulation of the proliferation of Human TF-1 cells is less than 0.2 ng/ml, corresponding to a specific activity of 5.0×10 6 IU/mg.
• Endotoxin: < 1.000 Eu/µg
• SwissProt/Accession: P08700
• Gene: IL3
• Residue: 24 to 143
• Sequence: RPFSTDLPKQYFTMINEIMEMLNKSPSPSEEPLDSNEKETLLEDTLLRPN LDVFLNASSKFHKNGLLIWNNLKEFLPLLPTPTPRGEPISIMENNWGDFQ RKLKKYLEALDNFLNFKNKP