Human HSBP1L1 full length protein
| Name | Human HSBP1L1 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab187413 |
| Category | Protein |
| Applications | SDS-PAGE MS |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag N-Terminus |
| Purity | >90% by SDS-PAGE. ab187413 was purified using conventional chromatography techniques |
| SwissProt/Accession | C9JCN9 |
| Gene | HSBP1L1 |
| Residue | 1 to 74 |
| Sequence | MGSSHHHHHHSSGLVPRGSHMGSMDVRGPEAPGGRALRDAAENLFQEQEH FQALTATLNLRMEEMGNRIEDLQKNVNDLMVQAGIENSIKEQMLKT |
| Supplier Page | Shop |
Product images
15% SDS-PAGE of ab187413 (3μg).