Active human LAIR2 full length protein
| Name | Active human LAIR2 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab182705 |
| Category | Protein |
| Prices | $515.00 |
| Sizes | 100 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Tag/Conjugation | His tag C-Terminus |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Measured by the ability of the immobilized protein to support the adhesion of HT-29 human colon adenocarcinoma cells. When 10000 cells/well are added to ab182705 coated plates (50 μg/ml with 100 μl/well), approximately >40% cells will adhere after 10 minutes at 37°C. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | Q6ISS4 |
| Gene | LAIR2 |
| Residue | 22 to 152 |
| Sequence | QEGALPRPSISAEPGTVISPGSHVTFMCRGPVGVQTFRLEREDRAKYKDS YNVFRLGPSESEARFHIDSVSEGNAGLYRCLYYKPPGWSEHSDFLELLVK ESSGGPDSPDTEPGSSAGTVPGTEASGFDAP |
| Supplier Page | Shop |
Product images
DTT-reduced SDS-PAGE analysis of ab182705 stained overnight with Coomassie Blue.