Human Human Growth Hormone full length protein
| Name | Human Human Growth Hormone full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab129131 |
| Category | Protein |
| Applications | SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Nicotiana benthamiana |
| Tag/Conjugation | His tag N-Terminus |
| Purity | > 97 % by SDS-PAGE. ab129131 is purified by sequential chromatography (FPLC). |
| Endotoxin | < 0.040 Eu/µg |
| SwissProt/Accession | P01241 |
| Gene | GH1 |
| Residue | 27 to 217 |
| Sequence | HHHHHHFPTIPLSRPFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSF LQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLR SVFANSLVYGASDSNVYDLLKDLEEGITLMGRLEDGSPRTGQIFKQTYSK FDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGFAG |
| Supplier Page | Shop |
Product images
SDS-PAGE/Western blot analysis of ab129131. Samples were loaded in 15% SDS-polyacrylamide gel and stained with Coomassie blue (lanes 1-3). Lane 1: Molecular weight marker (kDa) Lane 2: 0.05 ug ab129131 Lane 3: 0.3 ug ab129131 ab129131 was electrophoresed under reducing conditions on a 15% SDS-polyacrylamide gel, transferred by electroblotting to a NC membrane and visualized by immune-detection with specific antibody to Human Growth Hormone. Lane 4: immune-detection with specific anti-Human Growth Hormone 0.05 ug Lane 5: immune-detection with specific anti-Human Growth Hormone 0.3 ug