Recombinant Homo sapiens Mediator of DNA damage checkpoint protein 1(MDC1),partial

Name Recombinant Homo sapiens Mediator of DNA damage checkpoint protein 1(MDC1),partial
Supplier Signalway Antibody
Catalog AP74210
Category Protein
Prices $180.00, $295.00, $510.00, $839.00, $1,415.00, $2,256.00
Sizes 10 µg, 50 µg, 100 µg, 200 µg, 500 µg, 1 mg
Nature Recombinant
Source E.coli
Tag/Conjugation N-terminal 6xHis-SUMO-tagged
Gene MDC1
Sequence APKVLFTGVVDARGERAVLALGGSLAGSAAEASHLVTDRIRRTVKFLCALGRGIPILSLDWLHQSRKAGFFLPPDEYVVTDPEQEKNFGFSLQDALSRARERRLLEGYEIYVTPGVQPPPPQMGEIISCCGGTYLPSMPRSYKPQRVVITCPQDFPHCSIPLRVGLPLLSPEFLLTGVLKQEAKPEAFVLS
Description Recombinant Protein
Supplier Page Shop

Product images