Recombinant human Ankyrin repeat and SOCS box protein 6

Name Recombinant human Ankyrin repeat and SOCS box protein 6
Supplier Signalway Antibody
Catalog AP71543
Category Protein
Prices $260.00, $735.00, $1,240.00, $1,975.00
Sizes 50 µg, 200 µg, 500 µg, 1 mg
Species Reactivities Human
Nature Recombinant
Source E.coli
Tag/Conjugation His-SUMO-tag
Gene ASB6
Sequence MPFLHGFRRIIFEYQPLVDAILGSLGIQDPERQESLDRPSYVASEESRILVLTELLERKAHSPFYQEGVSNALLKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLVHHGADVNRRDREKLLCSMLWPAATGCRSTILRTFVSYWKEGQTSRPPPKMGTQCSPASSSCLVRPWEGTKRRPR
Description Recombinant Protein
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.