ROM1 Recombinant Protein Antigen

Name ROM1 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-58068PEP
Category Protein
Prices $199.00
Sizes 100 µl
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene ROM1
Sequence AHYKDTEVPGHCQAKRLVDELQLRYHCCGRHGYKDWFGVQWVSSRYLDPGDRDVADRIQSNVEGLYLTDGVPFSCCNPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWA
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ROM1
Supplier Page Shop