MIER1 Recombinant Protein Antigen

Name MIER1 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-55642PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody MIER1 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene MIER1
Sequence GPTGGNKKPLHADMDTNGYETDNLTTDPKLAHMTARNENDFDEKSERPAKRRRVNSNGKESPGSSEFFQEAVSHGKFEELENTDD
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MIER1
Supplier Page Shop