XAB2 Recombinant Protein Antigen

Name XAB2 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-58367PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody XAB2 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene XAB2
Sequence RAQVKHRCVTDPAYEDVNNCHERAFVFMHKMPRLWLDYCQFLMDQGRVTHTRRTFDRALRALPITQHSRIWPLYLRFLRSHPLPETAVRGYRRFLKLSPESAEEYIEYLKSSDRLD
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human XAB2
Supplier Page Shop