eIF2B4 Recombinant Protein Antigen

Name eIF2B4 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-58603PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody eIF2B4 Antibody
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene EIF2B4
Sequence VGREMTKEEKLQLRKEKKQQKKKRKEEKGAEPETGSAVSAAQCQVGPTRELPESGIQLGTPREKVPAGRSKAELRAER
Description A recombinant protein to eIF2B4
Supplier Page Shop