PIP5K2 gamma Recombinant Protein Antigen

Name PIP5K2 gamma Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-56140PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody PIP5K2 gamma Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene PIP4K2C
Sequence YLVSLTRNPPSESEGSDGRFLISYDRTLVIKEVSSEDIADMHSNLSNYHQY
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PIP5K2 gamma
Supplier Page Shop