ODR4/TTG1 Recombinant Protein Antigen

Name ODR4/TTG1 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-58718PEP
Category Protein
Prices $199.00
Sizes 100 µl
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene C1orf27
Sequence FCRTYDIHDPKSSARPADWKYQSGLSSSWLSLECTVHINIHIPLSATSVSYTLEKNTKNGLTRWAKEIENGVYLINGQVKDEDCDLLEGQKKSSRGNTQATSHCFDVRVLTQLLLNSDHRS
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ODR4/TTG1
Supplier Page Shop