SRP68 Recombinant Protein Antigen

Name SRP68 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-55721PEP
Category Protein
Prices $199.00
Sizes 100 µl
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene SRP68
Sequence AESEETKERLFESMLSECRDAIQVVREELKPDQKQRDYILEGEPGKVSNLQYLHSYLTYIKLSTAIKRNENMAKGLQRALLQQQPEDDSKRSPRPQDLIRLYDIILQNLVELL
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SRP68
Supplier Page Shop