Aquaporin-12A Recombinant Protein Antigen

• Supplier: Novus Biologicals
• Catalog: NBP2-54696PEP
• Category: Protein
• Prices: $229.00
• Sizes: 100 µl
• For Antibody: Aquaporin-12A Antibody
• Species Reactivities: Human
• Nature: Recombinant
• Source: E.coli
• Purity: >80% by SDS-PAGE and Coomassie blue staining
• Gene: AQP12A
• Sequence: FQRNLFYGQKNKYRAPRGKPAPASGDTQTPAKGSSVREPGRSGVE
• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Aquaporin-12A Source: E.coli Amino Acid Sequence: FQRNLFYGQKNKYRAPRGKPAPASGDTQTPAKGSSVREPGRSGVE