| Name | ARL17A Recombinant Protein Antigen |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-59794PEP |
| Category | Protein |
| Prices | $229.00 |
| Sizes | 100 µl |
| For Antibody | ARL17A Antibody |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E.coli |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Gene | ARL17A |
| Sequence | IRPLWQHFFQNTKGARSPGSTHQGSLASGVLPIKCSHVEFGMWKGGRSH |
| Description | A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ARL17A Source: E.coli Amino Acid Sequence: IRPLWQHFFQNTKGARSPGSTHQGSLASGVLPIKCSHVEFGMWKGGRSH |
| Supplier Page | Shop |