Solute carrier family 22 member 18 Recombinant Protein Antigen

• Supplier: Novus Biologicals
• Catalog: NBP2-57503PEP
• Category: Protein
• Prices: $199.00
• Sizes: 100 µl
• For Antibody: Solute carrier family 22 member 18 Antibody
• Species Reactivities: Human
• Nature: Recombinant
• Source: E.coli
• Purity: >80% by SDS-PAGE and Coomassie blue staining
• Gene: SLC22A18
• Sequence: PASTKGAKTDAQAPLPGGPRASVFDLKAIASLLRLPDVPRI
• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Solute carrier family 22 member 18