ZNF541 Recombinant Protein Antigen

Name ZNF541 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-56138PEP
Category Protein
Prices $199.00
Sizes 100 µl
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene ZNF541
Sequence PKKVKVDCDSFLCQNPGEPGLQEAQKAGGLPADASPLFRQLFLKSQEPLVSHEQMQVFQMITKSQRIFSHAQV
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZNF541
Supplier Page Shop