EIF4E3 Recombinant Protein Antigen

Name EIF4E3 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-54931PEP
Category Protein
Prices $199.00
Sizes 100 µl
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene EIF4E3
Sequence LLATIGEQFTDCAAADDEVIGVSVSVRDREDVVQVWNVNASLVGEATVLEKIY
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EIF4E3
Supplier Page Shop