RBM28 Recombinant Protein Antigen

Name RBM28 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-54998PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody RBM28 Antibody
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene RBM28
Sequence ENDDDDDDDDEEDGVFDDEDEEEENIESKVTKPVQIQKRAVKRPAPAKSSDHSEEDSDLEESDSIDDGEELAQSDTSTEEQEDKAVQVSNKKKRKLPSDVNEGKTVFIRNLSFDSEEEE
Description A recombinant protein to RBM28
Supplier Page Shop