EVI5L Recombinant Protein Antigen

Name EVI5L Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-54925PEP
Category Protein
Prices $199.00
Sizes 100 µl
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene EVI5L
Sequence PRKLVVGELQDELMSVRLREAQALAEGRELRQRVVELETQDHIHRNLLNRVEA
Description A recombinant protein to EVI5L. Source: E. coli Amino Acid Sequence: PRKLVVGELQDELMSVRLREAQALAEGRELRQRVVELETQDHIHRNLLNRVEA
Supplier Page Shop