MRPL47 Recombinant Protein Antigen

Name MRPL47 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-55844PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody MRPL47 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene MRPL47
Sequence YNRKRFFALPYVDHFLRLEREKRARIKARKENLERKKAKILLKKFPHLAEAQKSSLV
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MRPL47
Supplier Page Shop