THAP8 Recombinant Protein Antigen

Name THAP8 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-55908PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody THAP8 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene THAP8
Sequence MPKYCRAPNCSNTAGRLGADNRPVSFYKFPLKDGPRLQAWLQHMGCEHWVPSCHQHLCSEHFTPS
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human THAP8
Supplier Page Shop