DNAJC22 Recombinant Protein Antigen

Name DNAJC22 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-58463PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody DNAJC22 Antibody
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene DNAJC22
Sequence GETGFNSSCFQEWAKLYEFVHSFQDEKRQLAYQVLGLSEGATNEEIHRSYQELVKVWHPDHNLDQTEEAQRHFLEIQAAYEVLSQPRKP
Description A recombinant protein to DNAJC22
Supplier Page Shop