UNC93B Recombinant Protein Antigen

Name UNC93B Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-58752PEP
Category Protein
Prices $199.00
Sizes 100 µl
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene UNC93B1
Sequence NYITRMAQKYHEYSHYKEQDGQGMKQRPPRGSHAPY
Description A recombinant protein to UNC93B. Source: E. coli Amino Acid Sequence: NYITRMAQKYHEYSHYKEQDGQGMKQRPPRGSHAPY
Supplier Page Shop