METT5D1 Recombinant Protein Antigen

Name METT5D1 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-58462PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody METT5D1 Antibody
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene METTL15
Sequence RYPDMPTAADVVNALDQQALASILRTYGEEKHAKKIASAIVQARSIYPITRTQQLASIVAGAFPPSAIYTRKDLLQRSTHIATKTFQALRIFVNNELNEL
Description A recombinant protein to METT5D1
Supplier Page Shop