Gamma Adaptin Recombinant Protein Antigen

Name Gamma Adaptin Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-58947PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody Gamma Adaptin Antibody
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene AP1G1
Sequence FLLDGLSSQPLFNDIAAGIPSITAYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSSIVPAFNTGTI
Description A recombinant protein to Gamma Adaptin
Supplier Page Shop