PWP1 Recombinant Protein Antigen

Name PWP1 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-58751PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody PWP1 Antibody
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene PWP1
Sequence MSLGKPAASLAVHTDKVQTLQFHPFEAQTLISGSYDKSVALYDCRSPDESHRMWRFSGQIERVTWNHFSPCHFLASTDDGFVYNLDARSDKP
Description A recombinant protein to PWP1
Supplier Page Shop