PDE6 beta Recombinant Protein Antigen

Name PDE6 beta Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-58654PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody PDE6 beta Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene PDE6B
Sequence DRDEIQLILPTRARLGKEPADCDEDELGEILKEELPGPTTFDIYEFHFSDL
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PDE6 beta
Supplier Page Shop