ZNF586 Recombinant Protein Antigen

Name ZNF586 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-56434PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody ZNF586 Antibody
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene ZNF586
Sequence MLETLTLISSLGCWHGGEDEAAPSKQSTCIHIYKDQGGHSGERPYECGEYRKLFKNKSCLTEPRRDHKHRNVRTG
Description A recombinant protein to ZNF586
Supplier Page Shop