CCDC89 Recombinant Protein Antigen

Name CCDC89 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-57795PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody CCDC89 Antibody
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene CCDC89
Sequence PEERLEKQNEKLNNQEEETEFKELDGLREALANLRGLSEEERSEKAMLRSRIEEQSQLICILKRRSDEALERCQILELLNAELEEKMMQE
Description A recombinant protein to CCDC89
Supplier Page Shop