FAM18B2 Recombinant Protein Antigen

Name FAM18B2 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-56573PEP
Category Protein
Prices $199.00
Sizes 100 µl
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene TVP23C
Sequence MLQQDSNDDTEDVSLFDAEEETTNRPRKAK
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FAM18B2
Supplier Page Shop