MAGI1 Recombinant Protein Antigen

Name MAGI1 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-58071PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody MAGI1 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene MAGI1
Sequence IVEVNKKNVQALTHNQVVDMLVECPKGSEVTLLVQRGGLPVPKKSPKSQPLERKDSQNSSQHSVSSHRSLHTASPSHSTQVLPEFPPAEAQAPDQTD
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MAGI1
Supplier Page Shop