NOC3L Recombinant Protein Antigen

Name NOC3L Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-55900PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody NOC3L Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene NOC3L
Sequence DDLQLMKDLGQRVSFLTRDLSSSEPVHAKKRKHERIIDKYEKIPRTLQTAPEKELIHLLPIKDKSGIIPQTREKPV
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NOC3L. Source: E.coli Amino Acid Sequence: DDLQLMKDLGQRVSFLTRDLSSSEPVHAKKRKHERIIDKYEKIPRTLQTAPEKELIHLLPIKDKSGIIPQTREKPV
Supplier Page Shop