Zinc finger protein 774 Recombinant Protein Antigen

• Supplier: Novus Biologicals
• Catalog: NBP2-55296PEP
• Category: Protein
• Prices: $199.00
• Sizes: 100 µl
• For Antibody: Zinc finger protein 774 Antibody
• Species Reactivities: Human
• Nature: Recombinant
• Source: E.coli
• Purity: >80% by SDS-PAGE and Coomassie blue staining
• Gene: ZNF774
• Sequence: EHQVAKLNQDSSETAEQCGTSSERTNKDLSHTLSWGGNWEQGLELEGQHGTLPGEGQLESFSQERDLNKLL
• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Zinc finger protein 774