Active human LFA3 protein fragment
| Name | Active human LFA3 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab179975 |
| Category | Protein |
| Prices | $400.00 |
| Sizes | 100 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Tag/Conjugation | His tag C-Terminus |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Measured in a cell proliferation assay using Human CD3+ T cells in the presence of anti-CD3.The ED 50 for this effect is typically 1 - 5 µg/ml in the presence of anti-CD3 immobilized at 25 ng/ml. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P19256 |
| Gene | CD58 |
| Residue | 29 to 215 |
| Sequence | FSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFK NRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPT LTCALTNGSIEVQCMIPEYYNSHRGLIMYSWDCPMEQCKRNSTSIYFKME NDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHR |
| Supplier Page | Shop |
Product images
DTT-reduced SDS-PAGE analysis of ab179975 stained overnight with Coomassie Blue. DTT-reduced protein migrates at 30-45 kDa due to different glycosylation.