Human IL13 receptor alpha 2 protein fragment
| Name | Human IL13 receptor alpha 2 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab114368 |
| Category | Protein |
| Applications | ELISA WB SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| SwissProt/Accession | Q14627 |
| Gene | IL13RA2 |
| Residue | 27 to 126 |
| Sequence | DTEIKVNPPQDFEIVDPGYLGYLYLQWQPPLSLDHFKECTVEYELKYRNI GSETWKTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQSSWAET |
| Supplier Page | Shop |
Product images
12.5% SDS-PAGE showing ab114368 at approximately 36.63kDa stained with Coomassie Blue.