Active human Lymphotactin full length protein

• Supplier: Abcam
• Catalog: ab202785
• Category: Protein
• Prices: $359.00
• Sizes: 5 µg
• Applications: FA HPLC SDS-PAGE
• Species Reactivities: Human
• Nature: Recombinant
• Source: E. coli
• Purity: > 97 % by SDS-PAGE. > 97 % by HPLC.
• Bioactivity: Fully biologically active when compared to standard. Determined by its ability to chemoattract Human T cells using a concentration range of 10.0-100.0 ng/ml.
• Endotoxin: < 1.000 Eu/µg
• SwissProt/Accession: P47992
• Gene: XCL1
• Residue: 23 to 114
• Sequence: GSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADP QATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG