Human intestinal FABP full length protein
| Name | Human intestinal FABP full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab115502 |
| Category | Protein |
| Applications | SDS-PAGE WB ELISA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag N-Terminus |
| Purity | > 95 % by SDS-PAGE. ab115502 is purified using Ni-NTA chromatography. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P12104 |
| Gene | FABP2 |
| Residue | 2 to 131 |
| Sequence | MKHHHHHHASAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTI TQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLI GKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD |
| Supplier Page | Shop |
Product images
14% SDS-PAGE showing ab115502 Lane 1: M.W. marker – 14, 21, 31, 45, 66, 97 kDa Lane 2: reduced and boiled sample, 5µg/lane. Lane 3: non-reduced and non-boiled sample, 5µg/lane.