| Name | Active human MDC full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab191737 |
| Category | Protein |
| Prices | $192.00 |
| Sizes | 20 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Determined by the ability of ab191737 to chemoattract Human T cells using a concentration range of 10-50 ng/mL. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | O00626 |
| Gene | CCL22 |
| Residue | 25 to 93 |
| Sequence | GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKE ICADPRVPWVKMILNKLSQ |
| Supplier Page | Shop |