Active human MDH2 full length protein
| Name | Active human MDH2 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab99238 |
| Category | Protein |
| Prices | $239.00, $883.00 |
| Sizes | 50 µg, 250 µg |
| Applications | SDS-PAGE MS FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag N-Terminus |
| Purity | > 95 % by SDS-PAGE. ab99238 is purified using conventional chromatography techniques. |
| Bioactivity | Specific activity is > 30 units/mg, and is defined as the amount of enzyme that cleaves 1umole of oxalacetate and beta-NADH to L-malate and beta-NAD per minute at pH7.5 at 25°C Activity Assay Prepare assay buffer into a suitable container and pre-chill on ice before use: The final concentrations are 100 mM Potassium phosphate, 0.13mM beta-nicotinamide adenine dinucleotide, reduced form, 0.25mM oxalacetic acid. Add recombinant MDH protein with various concentrations (0.1ug, 0.5ug, 1ug) in assay buffer. Mix by inversion and equilibrate to 1°C and monitor at A340nm until the value is constant using a spectrophotometer. Record the increase at A340nm for approximately 2 minutes |
| SwissProt/Accession | P40926 |
| Gene | MDH2 |
| Residue | 25 to 338 |
| Sequence | MGSSHHHHHHSSGLVPRGSHM AKVAVLGASGGIGQPLSLLLKNSPLVSRL TLYDIAHTPGVAADLSHIETKAAVKGYLGPEQLPDCLKGCDVVVIPAGVP RKPGMTRDDLFNTNATIVATLTAACAQHCPEAMICVIANPVNSTIPITAE VFKKHGVYNPNKIFGVTTLDIVRANTFVAELKGLDPARVNVPVIGGHAGK TIIPLISQCTPKVDFPQDQLTALTGRIQEAGTEVVKAKAGAGSATLSMAY AGARFVFSLVDAMNGKEGVVECSFVKSQETECTYFSTPLLLGKKGIEKNL GIGKVSSFEEKMISDAIPELKASIKKGEDFVKTLK |
| Supplier Page | Shop |
Product images
15% SDS-PAGE showing ab99238 at approximately 35.2kDa (3µg).