Active human MIG full length protein

Name Active human MIG full length protein
Supplier Abcam
Catalog ab202816
Category Protein
Prices $359.00
Sizes 5 µg
Applications FA HPLC SDS-PAGE
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity > 97 % by SDS-PAGE. > 97 % by HPLC.
Bioactivity ab202816 is fully biologically active when compared to standard. Determined by its ability to chemoattract Human peripheral blood T-Lymphocytes using a concentration range of 10.0-100.0 ng/mL.
Endotoxin < 1.000 Eu/µg
SwissProt/Accession Q07325
Gene CXCL9
Residue 23 to 125
Sequence TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQ TCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQK KTT
Supplier Page Shop