Human Laminin gamma 1 full length protein
| Name | Human Laminin gamma 1 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab114156 |
| Category | Protein |
| Applications | ELISA WB SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| SwissProt/Accession | P11047 |
| Gene | LAMC1 |
| Residue | 1 to 39 |
| Sequence | MNKRRTSHRIWKNKLPEYMRRPKGPVTKLWRSMPAWLS |
| Supplier Page | Shop |
Product images
12.5% SDS-PAGE analysis of ab114156, stained with Coomassie Blue.