Human LD78 beta full length protein
| Name | Human LD78 beta full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab104122 |
| Category | Protein |
| Applications | MS SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag N-Terminus |
| Purity | > 90 % by SDS-PAGE. ab104122 was purifed by conventional chromatography, after refolding of the isolated inclusion bodies in a renaturation buffer. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P16619 |
| Gene | CCL3L1 |
| Residue | 26 to 93 |
| Sequence | MGSSHHHHHHSSGLVPRGSHMS LAADTPTACCFSYTSRQIPQNFIADYFE TSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA |
| Supplier Page | Shop |
Product images
15% SDS-PAGE analysis of 3µg ab104122.