Active human NAP2 full length protein

• Supplier: Abcam
• Catalog: ab192100
• Category: Protein
• Prices: $192.00
• Sizes: 10 µg
• Applications: SDS-PAGE FA
• Species Reactivities: Human
• Nature: Recombinant
• Source: E. coli
• Purity: >95% by SDS-PAGE .
• Bioactivity: Determined by its ability to chemoattract Human monocytes using a concentration range of 2.0-40.0 ng/mL.
• Endotoxin: < 1.000 Eu/µg
• SwissProt/Accession: P02775
• Gene: PPBP
• Residue: 59 to 128
• Sequence: AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDP DAPRIKKIVQKKLAGDESAD