Active human NCR3 protein fragment
| Name | Active human NCR3 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab184896 |
| Category | Protein |
| Prices | $824.00 |
| Sizes | 100 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Measured by its binding ability in a functional ELISA. Immobilized rh B7-H6 Fc Chimera at 1 µg/mL (100 µL/well), the concentration of NCR3 Fc Chimera that produces 50% of the optimal binding response is found to be approximately 10 - 50 ng/ml. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | O14931 |
| Gene | NCR3 |
| Residue | 19 to 135 |
| Sequence | LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRN GTPEFRGRLA PLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLG VGTGNGTRLVVEKEHPQLG |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of ab184896; DTT-reduced (1) and non-reduced (2) stained overnight with Coomassie Blue. As a result of glycosylation, DTT-reduced Protein migrates as 45-55 kDa and non-reduced protein migrates as 90-110 kDa.