Active human NEDD8 full length protein

• Supplier: Abcam
• Catalog: ab190424
• Category: Protein
• Prices: $461.00
• Sizes: 50 µg
• Applications: FA SDS-PAGE
• Species Reactivities: Human
• Nature: Recombinant
• Source: E. coli
• Purity: >95% by SDS-PAGE .
• Bioactivity: >100:1 signal to noise ratio with 10 pM NEDP1. K m of NEDP1 for NEDD8-AML (NEDD8 conjugated to aminoluciferin) is 69 nM.
• SwissProt/Accession: Q15843
• Gene: NEDD8
• Residue: 1 to 76
• Sequence: MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQM NDEKTAADYKILGGSVLHLVLALRGG