| Name | Active human Neuregulin 1 beta 2 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab73753 |
| Category | Protein |
| Prices | $239.00 |
| Sizes | 50 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | > 95 % by SDS-PAGE. ab73753 is purified by proprietary chromatographic techniques and 0.2µm filtered. Purity is greater than 96.0% as determined by RP-HPLC and SDS-PAGE. |
| Bioactivity | active |
| SwissProt/Accession | Q02297 |
| Gene | NRG1 |
| Residue | 177 to 237 |
| Sequence | shlvkcaekektfcvnggecfmvkdlsnpsrylckcpneftgdrcqnyvm asfykaeelyq |
| Supplier Page | Shop |